Chemistry data
- Class
- dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist
- Molecular weight
- 4813.5 g/mol
- Sequence
- YAibEGTFTSDVSSYLEEQAAKEFIAWLVKGRG-OH (39 amino acids; Aib = aminoisobutyric acid at position 2; C-20 fatty diacid conjugated to lysine at position 20)
- Half-life
- approximately 5 days (subcutaneous)
- Routes
- subcutaneous
- Studied doses
- subcutaneous 2.5 mg, 5 mg, 10 mg, 15 mg once weekly
Tirzepatide is a synthetic 39-amino-acid linear peptide engineered to simultaneously activate glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors, making it the first dual incretin agonist approved for clinical use. The compound incorporates a C-20 fatty diacid moiety conjugated to lysine at position 20, enabling prolonged albumin binding and a half-life of approximately 5 days suitable for once-weekly subcutaneous administration. Research demonstrates that tirzepatide lowers blood glucose and reduces body weight through complementary mechanisms including glucose-dependent insulin secretion, glucagon suppression, gastric emptying delay, and central appetite regulation. The compound received FDA approval under the brand names Mounjaro (type 2 diabetes) and Zepbound (obesity), with clinical trial data from the SURPASS and SURMOUNT programs establishing efficacy across multiple metabolic endpoints.
Regulatory Status
- United States
- Fda Approved
- European Union
- Ema Approved
- United Kingdom
- Mhra Approved
What is this compound?
Tirzepatide is a synthetic polypeptide composed of 39 amino acids engineered from the native glucose-dependent insulinotropic polypeptide (GIP) sequence with strategic modifications to enable dual receptor engagement. The peptide incorporates an aminoisobutyric acid (Aib) substitution at position 2 to resist enzymatic degradation, and a C-20 fatty diacid moiety conjugated to lysine at position 20 that promotes albumin binding in the subcutaneous compartment, extending the half-life to approximately 5 days. This pharmacokinetic profile enables once-weekly subcutaneous dosing, a significant practical advantage over shorter-acting incretin therapies.\n\nDeveloped by Eli Lilly and Company, tirzepatide represents the first approved dual GIP/GLP-1 receptor agonist, commonly referred to as a twincretin. Unlike selective GLP-1 receptor agonists such as semaglutide
Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization or liraglutide, tirzepatide engages both incretin receptor systems with distinct binding characteristics described as imbalanced and biased, favoring GIP receptor signaling while maintaining clinically significant GLP-1 receptor activation PMID: 32730231 . The compound was engineered to exploit the complementary metabolic effects of both incretin hormones: GIP enhances insulin secretion and modulates adipocyte metabolism, while GLP-1 suppresses glucagon, slows gastric emptying, and reduces appetite through central nervous system pathways.\n\nThe United States Food and Drug Administration approved tirzepatide for two indications: as an adjunct to diet and exercise for improving glycemic control in adults with type 2 diabetes (marketed as Mounjaro), and for chronic weight management in adults with obesity or overweight with at least one weight-related comorbidity (marketed as Zepbound). The European Medicines Agency and the UK Medicines and Healthcare products Regulatory Agency have similarly approved tirzepatide. Clinical development spans the SURPASS program (type 2 diabetes) and the SURMOUNT program (obesity), involving tens of thousands of participants across multiple phase 3 trials.
How it works
Tirzepatide exerts its metabolic effects through simultaneous agonism at two incretin receptors: the glucose-dependent insulinotropic polypeptide receptor (GIPR) and the glucagon-like peptide-1 receptor (GLP-1R). Research characterizes tirzepatide as an imbalanced and biased dual agonist, meaning it activates the two receptors with different potencies and signaling profiles rather than acting as an equipotent, unbiased activator of both PMID: 32730231 . Specifically, tirzepatide shows preferential engagement of the GIPR relative to the GLP-1R, a pharmacological profile that preclinical evidence suggests may be superior to unbiased dual agonism for glucose and weight control PMID: 34003802 .\n\nAt the pancreatic level, tirzepatide enhances glucose-dependent insulin secretion from beta cells through both GIP and GLP-1 receptor pathways. This dual incretin stimulation produces greater insulinotropic effects than either receptor alone, with the glucose-dependency reducing the risk of hypoglycemia during euglycemic and hypoglycemic conditions. Simultaneously, GLP-1 receptor activation on alpha cells suppresses glucagon secretion during hyperglycemia, while GIP receptor signaling preserves appropriate glucagon responses during hypoglycemia, creating a balanced counter-regulatory profile PMID: 21984584 .\n\nBeyond the pancreas, tirzepatide delays gastric emptying through vagal afferent signaling, contributing to postprandial glucose reduction and early satiety. The compound also acts on central nervous system circuits involved in appetite regulation. Research indicates that GLP-1 receptor agonism activates brainstem cholecystokinin neurons that mediate appetite suppression, while GIP receptor activation modulates this pathway to attenuate the nausea and aversive effects typically associated with GLP-1-based therapies [PMID: 34844019, 34380697]. This nausea-mitigating effect of GIP co-agonism may explain the improved gastrointestinal tolerability observed with tirzepatide compared to high-dose selective GLP-1 receptor agonists.\n\nThe GIP receptor component also contributes weight-independent insulin sensitization. Studies in obese mouse models demonstrated that GIPR agonism mediates improvements in insulin sensitivity that are not attributable to body weight reduction alone PMID: 34003802 . Further research has shown that tirzepatide modulates adipocyte nutrient metabolism through long-acting GIP receptor activation, potentially influencing lipid storage and mobilization in adipose tissue PMID: 38878772 .
- Dual agonism at GIP and GLP-1 receptors with imbalanced biased signaling favoring GIPR engagement, enhancing insulin secretion in a glucose-dependent manner
- Suppression of glucagon secretion via GLP-1 receptor activation on pancreatic alpha cells during hyperglycemia
- Slowing of gastric emptying contributing to postprandial glucose reduction and increased satiety
- Central appetite suppression via brainstem circuits, modulated by GIP receptor activation attenuating GLP-1-induced nausea
- GIPR-mediated weight-independent insulin sensitization and adipocyte nutrient metabolism modulation
Research Findings
Clinical evidence from the SURPASS and SURMOUNT trial programs establishes tirzepatide as one of the most effective metabolic interventions studied to date. In the SURPASS-1 trial, tirzepatide monotherapy in patients with type 2 diabetes produced dose-dependent HbA1c reductions of up to 1.87% (15 mg dose) versus placebo, with mean body weight reductions of up to 11.0 kg over 40 weeks PMID: 34186022 . The SURPASS-2 trial demonstrated that tirzepatide was noninferior and superior to semaglutide
Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization 1 mg for HbA1c reduction, with tirzepatide 15 mg achieving a mean HbA1c reduction of 2.58% compared to 1.74% with semaglutide, alongside greater weight loss PMID: 34370970 .\n\nFor obesity, the SURMOUNT-1 trial enrolled adults without diabetes with a body mass index of 30 or greater (or 27 with comorbidities). At 72 weeks, tirzepatide produced mean body weight reductions of 15.0% (5 mg), 19.5% (10 mg), and 20.9% (15 mg) compared to 3.1% with placebo PMID: 35210595 . These results exceed those previously reported for any approved pharmacotherapy for obesity. The SURMOUNT-3 trial demonstrated that tirzepatide following intensive lifestyle intervention led to additional weight reduction of 18.4% (10 mg) and 24.2% (15 mg) versus 2.7% with placebo over 72 weeks PMID: 37840095 .\n\nBeyond glycemic and weight outcomes, tirzepatide demonstrates cardiovascular and metabolic benefits. A pre-specified meta-analysis of the SURPASS program found no increased cardiovascular risk and signals of cardiovascular benefit, including systolic blood pressure reduction of 5.4 to 8.5 mmHg across doses PMID: 35210595 . Research also shows improvements in lipoprotein biomarkers associated with insulin resistance and cardiovascular risk, including reductions in triglycerides, VLDL cholesterol, and apolipoprotein C-III PMID: 33462955 . The SURPASS-3 MRI substudy demonstrated significant reductions in liver fat content and abdominal adipose tissue with tirzepatide versus insulin degludec PMID: 35468325 . Kidney outcomes analyses from SURPASS-4 showed reduced albuminuria progression with tirzepatide compared to insulin glargine PMID: 36152639 .\n\nHead-to-head comparison with semaglutide for obesity treatment (SURMOUNT-5) demonstrated tirzepatide superiority, with 20.2% weight reduction versus 13.7% with semaglutide 2.4 mg at 72 weeks PMID: 40353578 .
- blood-sugar-control clinical
- fat-loss clinical
- metabolic-health clinical
- cardiovascular-health clinical
Dosage Context Explained
The FDA-approved dosing regimen for tirzepatide begins with a 2.5 mg subcutaneous injection once weekly for 4 weeks as a starting dose, followed by escalation to 5 mg once weekly. Depending on glycemic response and tolerability, the dose may be increased in 2.5 mg increments at minimum 4-week intervals to a maximum of 15 mg once weekly. For type 2 diabetes (Mounjaro), the target maintenance doses are 5 mg, 10 mg, or 15 mg weekly based on individual patient needs. For chronic weight management (Zepbound), the recommended maintenance doses are 5 mg, 10 mg, or 15 mg weekly, with dose escalation guided by weight loss response and tolerability.\n\nThe subcutaneous injection is administered in the abdomen, thigh, or upper arm, with rotation of injection sites recommended. Dosing may be administered at any time of day without regard to meals. In clinical trials, the dose-escalation protocol minimized gastrointestinal adverse events, which were most frequent during the initial titration phase. The 5-day half-life allows some flexibility in timing, as the once-weekly schedule can be adjusted by up to 4 days if needed, provided the minimum interval between doses is at least 3 days.\n\nThe phase 2 dose-finding study established the dose-response relationship, with HbA1c reductions plateauing between 10 mg and 15 mg doses while weight loss continued to increase dose-dependently up to 15 mg PMID: 33325008 . All SURPASS trials utilized the 5 mg, 10 mg, and 15 mg doses, with the 2.5 mg dose used only as the mandatory starting dose. Researchers should note that any use outside approved indications remains investigational, and the clinical evidence base is derived from populations meeting specific trial enrollment criteria.
-
- Administration Routes
- subcutaneous
- Range
- 2.5 mg, 5 mg, 10 mg, 15 mg once weekly
FDA-approved dosing: 2.5 mg starting dose titrated to 5 mg, 10 mg, or 15 mg once weekly for type 2 diabetes (Mounjaro) and obesity (Zepbound)
🧮 Reconstitution Calculator
Determine exactly how much bacteriostatic water to add and how many units to draw for your target dose.
Side Effects: Research Context
Clinical trials documented a side effect profile dominated by gastrointestinal events, consistent with the GLP-1 receptor agonist class. The most frequently reported adverse events across the SURPASS and SURMOUNT programs were nausea (occurring in 5-18% of participants depending on dose), diarrhea (5-17%), decreased appetite (5-11%), vomiting (2-9%), constipation (4-7%), and dyspepsia (3-5%). Injection site reactions occurred in approximately 2-5% of participants. These gastrointestinal events were generally mild to moderate in severity and were most frequent during the dose-escalation phase, typically resolving within 4 to 8 weeks of initiating a new dose level [PMID: 34186022, 35210595].\n\nThe gastrointestinal tolerability profile of tirzepatide warrants particular attention in the context of dual incretin agonism. Research suggests that GIP receptor activation attenuates GLP-1 receptor agonist-induced nausea and emesis through brainstem circuit modulation, which may partially explain why tirzepatide demonstrates comparable or lower rates of nausea and vomiting despite achieving greater weight loss than selective GLP-1 receptor agonists PMID: 34380697 .\n\nIn the SURPASS-5 trial, where tirzepatide was added to insulin glargine, hypoglycemia (blood glucose below 54 mg/dL) was infrequent and occurred at rates comparable to placebo when background insulin was appropriately titrated PMID: 35133415 . No clinically significant changes in heart rate, pancreatitis, or thyroid C-cell malignancy were observed across the clinical development program. However, tirzepatide carries a boxed warning regarding the risk of thyroid C-cell tumors based on rodent studies, and it is contraindicated in patients with a personal or family history of medullary thyroid carcinoma or multiple endocrine neoplasia syndrome type 2.
- nausea
- diarrhea
- decreased appetite
- vomiting
- constipation
- dyspepsia
- abdominal pain
- injection site reactions
Frequently Asked Questions
Frequently Asked Questions
-
Tirzepatide activates both GIP and GLP-1 receptors, whereas semaglutide selectively targets only the GLP-1 receptor. This dual mechanism enables tirzepatide to achieve glycemic control and weight reduction through complementary pathways: GIP receptor agonism enhances insulin secretion and modulates adipocyte metabolism, while GLP-1 receptor activation suppresses glucagon, slows gastric emptying, and reduces appetite. Clinical head-to-head data from SURPASS-2 showed tirzepatide achieving greater HbA1c reduction than semaglutide 1 mg, and SURMOUNT-5 demonstrated superior weight loss with tirzepatide versus semaglutide 2.4 mg [PMID: 34370970, 40353578]. Additionally, GIP receptor activation appears to attenuate GLP-1-associated nausea, potentially improving tolerability.
-
In the SURMOUNT-1 trial in adults with obesity without diabetes, tirzepatide produced mean body weight reductions of 15.0% (5 mg), 19.5% (10 mg), and 20.9% (15 mg) compared to 3.1% with placebo over 72 weeks. In the SURMOUNT-3 trial following intensive lifestyle intervention, tirzepatide achieved additional reductions of 18.4% (10 mg) and 24.2% (15 mg). The SURMOUNT-5 head-to-head comparison found tirzepatide produced 20.2% weight loss versus 13.7% with semaglutide 2.4 mg at 72 weeks [PMID: 35210595, 37840095, 40353578].
-
The most common side effects are gastrointestinal: nausea, diarrhea, decreased appetite, vomiting, constipation, and dyspepsia. These events are generally mild to moderate, most frequent during dose escalation, and typically resolve within 4 to 8 weeks. Injection site reactions occur in a small percentage of participants. GIP receptor co-agonism may attenuate nausea compared to selective GLP-1 receptor agonists. Tirzepatide carries a boxed warning regarding thyroid C-cell tumors based on animal studies, though no such events were observed in clinical trials [PMID: 34186022, 35210595].
-
Tirzepatide is FDA-approved in the United States for type 2 diabetes (Mounjaro, approved May 2022) and chronic weight management (Zepbound, approved November 2023). The European Medicines Agency and UK MHRA have granted similar approvals. It is available by prescription only. The compound is administered as a once-weekly subcutaneous injection with dose escalation from 2.5 mg to a maximum of 15 mg. Any use outside approved indications should be considered investigational.