Chemistry data
- Class
- naturally occurring 43-amino acid actin-sequestering peptide
- Molecular weight
- 4921 g/mol
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids, acetylated N-terminus)
- Half-life
- estimated 2–6 hours in circulation (rapidly distributed to tissues)
- Routes
- ophthalmic (eye drops — RGN-259 clinical formulation) · topical · subcutaneous · intravenous
- Studied doses
- ophthalmic 0.1% RGN-259 solution, applied as eye drops (clinical trial formulation) · topical varies by study; typically applied directly to wound site in preclinical models
Where most tissue-repair peptides act on a single pathway, Thymosin Beta-4 (Tβ4) operates at the intersection of several. This 43-amino acid protein exists naturally in virtually every cell in the body — and its influence extends from actin dynamics to angiogenesis, stem cell mobilization, and anti-inflammatory signaling PMID: 16099219 .
Unlike its synthetic fragment ** TB-500
TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis , which isolates just seven amino acids from the actin-binding domain, Tβ4** is the full-length parent protein. It retains the actin-sequestering function but adds regulatory roles that the fragment cannot replicate — including DNA polymerase modulation and broader extracellular matrix remodeling PMID: 31333080 .
This breadth is why Thymosin Beta-4 has advanced further than most regenerative peptides in clinical development. Its ophthalmic formulation, RGN-259, has completed Phase 3 trials for corneal wound healing in neurotrophic keratopathy PMID: 36613994 — a milestone no other actin-binding peptide has reached.
Regulatory Status
- United States
- Investigational New Drug
- European Union
- Investigational
- United Kingdom
- Investigational
What is this compound?
Thymosin Beta-4 was first isolated in 1981 from bovine thymus tissue, when researchers were cataloging the peptide components of what they called "thymosin fraction 5." The original interest was immunological — the protein appeared to influence T-cell maturation. Its amino acid sequence was determined that same year: 43 residues, acetylated at the N-terminus, with a molecular weight of approximately 4,921 daltons PMID: 6940133 .
It took another two decades for the field to recognize what Tβ4 was actually doing. By the early 2000s, researchers had established that the protein was not primarily an immune regulator — it was a master actin buffer. Found in all cell types except red blood cells, Tβ4 binds to monomeric G-actin and prevents it from polymerizing into filamentous F-actin. This single function places Tβ4 at the center of every cellular process that depends on cytoskeletal rearrangement: migration, division, wound closure, angiogenesis PMID: 16099219 .
The protein is encoded by the TMSB4X gene on the X chromosome. It is water-soluble, highly conserved across mammalian species, and present at intracellular concentrations that can reach 200–500 μM in some cell types — making it one of the most abundant cytoplasmic proteins in the body.
What distinguishes Thymosin Beta-4 from its synthetic derivative ** TB-500
TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis is scope. TB-500 captures the seven amino acids responsible for actin binding (the LKKTETQ sequence). Tβ4 does that and more: it regulates DNA polymerase activity, promotes protein synthesis, and influences stem cell differentiation** — functions that require the full 43-amino acid structure and cannot be replicated by the isolated fragment [PMID: 22074294, PMID: 31333080].
How it works
Every cell in the body faces a fundamental tension: it needs a rigid skeleton to maintain its shape, but it also needs to dissolve that skeleton to move, divide, or repair damage. Thymosin Beta-4 is the protein that manages this balance.
The central mechanism is G-actin sequestration. Actin exists in two pools: free monomers (G-actin) and polymerized filaments (F-actin) that form the structural framework of the cell. Tβ4 binds to G-actin monomers with high affinity, keeping them in a soluble, non-polymerized state. When a cell needs to migrate — toward a wound, for instance — it locally releases Tβ4's grip on actin, allowing rapid filament assembly at the leading edge. This controlled supply-and-demand system gives cells the flexibility to reorganize their cytoskeleton on command PMID: 16099219 .
Beyond cytoskeletal regulation, Tβ4 promotes angiogenesis — the growth of new blood vessels. It does this through upregulation of VEGF (vascular endothelial growth factor) and stabilization of HIF-1α (hypoxia-inducible factor), both of which drive vessel formation in oxygen-deprived tissues PMID: 22074294 . In animal models, this has translated to measurably increased vascular density at injury sites.
Tβ4 also suppresses NF-κB, the transcription factor that orchestrates the inflammatory cascade. By dampening this pathway, the protein reduces the production of pro-inflammatory cytokines and limits tissue damage from excessive immune activation PMID: 31333080 . This anti-inflammatory effect operates in parallel with its repair mechanisms — the cell can begin rebuilding without waiting for inflammation to fully resolve.
A fourth mechanism, increasingly recognized in the literature, is Tβ4's role in stem cell mobilization. The protein promotes the migration and differentiation of progenitor cells, including those that form new blood vessels and regenerate damaged tissue PMID: 22074294 . This positions Tβ4 not just as a repair molecule, but as a signal that recruits the body's own regenerative capacity.
- G-actin sequestration and cytoskeletal regulation
- Angiogenesis promotion via VEGF and HIF-1α pathways
- Anti-inflammatory action (NF-κB suppression, cytokine modulation)
- Anti-apoptotic signaling and cell survival promotion
- Stem/progenitor cell mobilization and differentiation
- Extracellular matrix remodeling and collagen regulation
Research Findings
The most advanced clinical evidence for Thymosin Beta-4 exists in ophthalmology. RGN-259, a sterile preservative-free eye drop formulation containing 0.1% Tβ4, has been evaluated in multiple Phase 3 clinical trials for dry eye disease (the ARISE program, >1,600 patients) and neurotrophic keratopathy (the SEER trials). In SEER-1, 60% of RGN-259-treated patients achieved complete corneal healing, and in the most recent published trial, Tβ4-treated subjects showed statistically significant healing with no recurrence of epithelial defects after treatment cessation PMID: 36613994 . These results established Tβ4 as a genuine clinical-stage compound — not merely a research curiosity.
For wound healing more broadly, the preclinical evidence is extensive. In animal models, Tβ4 administration has been associated with accelerated wound closure, improved collagen deposition, enhanced epithelialization, and better-organized scar tissue [PMID: 22074294, PMID: 20536453]. The mechanism combines all four of Tβ4's primary functions: actin-mediated cell migration toward the wound bed, new blood vessel formation to supply the repair site, anti-inflammatory suppression to reduce collateral damage, and stem cell recruitment to generate new tissue.
Cardiac repair represents a particularly active area of preclinical investigation. Tβ4 promotes cardiomyocyte migration and survival in culture, and in animal models of myocardial infarction, it has been associated with reduced infarct size and improved cardiac function PMID: 22074294 . The proposed mechanism involves Tβ4's ability to mobilize epicardial progenitor cells and promote revascularization of damaged myocardium. These findings have not yet been tested in human clinical trials.
Hair growth is another preclinical finding: Tβ4 has been shown to promote hair follicle growth and cycling in both normal and aged rodents PMID: 20536453 . The mechanism appears to involve dermal papilla cell migration and angiogenesis at the follicular level.
- wound-healing clinical
- corneal-repair clinical_phase_3
- cardiac-repair preclinical
- anti-inflammatory preclinical
- hair-growth preclinical
Dosage Context Explained
Thymosin Beta-4 has progressed further toward clinical dosing than most regenerative peptides, but the available data remains limited.
The most precise dosing information comes from ophthalmic clinical trials. RGN-259 is formulated as a 0.1% sterile, preservative-free solution applied as eye drops, with dosing protocols varying between trials for dry eye disease and neurotrophic keratopathy. In the SEER-1 trial for neurotrophic keratopathy, patients received the drops according to a defined schedule over four weeks PMID: 36613994 .
For non-ophthalmic applications, dosing data comes almost exclusively from preclinical animal models. Topical application to wound sites and subcutaneous injection have both been studied, but doses vary substantially by species, body weight, and experimental design. No standardized dosing protocols exist for systemic administration in humans.
The critical distinction: unlike ** TB-500
TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis **, which has only anecdotal human-use reports outside of controlled research, Tβ4 has actual clinical trial data — albeit limited to ophthalmic formulations. Extrapolation from corneal application to systemic or injection-based use remains unsupported by controlled human evidence.
-
- Administration Routes
- ophthalmic
- Range
- 0.1% RGN-259 solution, applied as eye drops (clinical trial formulation)
Phase 3 clinical trials for neurotrophic keratopathy and dry eye disease
-
- Administration Routes
- topical
- Range
- varies by study; typically applied directly to wound site in preclinical models
animal wound-healing studies
🧮 Reconstitution Calculator
Determine exactly how much bacteriostatic water to add and how many units to draw for your target dose.
Side Effects: Research Context
The safety profile of Thymosin Beta-4 is among the most favorable of any regenerative peptide in clinical development, based on available data.
In the Phase 3 RGN-259 clinical trials involving over 1,600 patients, Tβ4 eye drops were generally well-tolerated, with no serious adverse events attributed to the compound PMID: 36613994 . Mild ocular discomfort was reported by some participants but was self-resolving and did not require treatment discontinuation.
For non-ophthalmic applications, safety data is limited to preclinical models. Animal studies have not revealed significant toxicity at therapeutic doses, but no human clinical trials exist for injectable or systemic Tβ4 use.
The principal theoretical concern remains Tβ4's angiogenic and growth-promoting mechanisms. Because the protein stimulates blood vessel formation and cell proliferation, there is a theoretical risk that it could promote tumor growth in individuals with active malignancy PMID: 31333080 . This contraindication is based on mechanistic reasoning rather than clinical observation — no tumor-promoting effects have been documented in published trials — but it warrants caution in any future systemic application.
- generally well-tolerated in clinical trials (ophthalmic formulation)
- mild ocular discomfort reported in some RGN-259 trial participants (self-resolving)
- no serious adverse events attributed to Tβ4 in published Phase 3 data
Frequently Asked Questions
Frequently Asked Questions
-
Thymosin Beta-4 (Tβ4) is a naturally occurring 43-amino acid protein encoded by the TMSB4X gene, found in virtually every cell type in the body. TB-500 is a synthetic seven-amino acid fragment (LKKTETQ) derived from Tβ4's actin-binding domain. While TB-500 captures the core actin-sequestering function, Tβ4 retains additional biological capabilities — including regulation of DNA polymerase, promotion of protein synthesis, stem cell mobilization, and broader extracellular matrix remodeling — that require the full-length protein structure.
-
Tβ4 primarily functions as a G-actin sequestration protein: it binds monomeric actin and prevents polymerization into filaments, maintaining a dynamic pool of available actin for cytoskeletal rearrangement during cell migration and wound closure. Beyond this, Tβ4 promotes angiogenesis through VEGF and HIF-1α pathways, suppresses NF-κB-mediated inflammation, supports anti-apoptotic signaling, and mobilizes stem/progenitor cells for tissue regeneration.
-
Yes. RGN-259, an ophthalmic formulation of Tβ4, has completed Phase 3 clinical trials for both dry eye disease (the ARISE program, over 1,600 patients) and neurotrophic keratopathy (the SEER trials). Results showed statistically significant improvements in corneal healing and ocular comfort. Tβ4 is the first actin-binding peptide to reach Phase 3 clinical development. Non-ophthalmic applications remain in preclinical stages.
-
Tβ4's ophthalmic formulation (RGN-259) holds Investigational New Drug status with the FDA and has been evaluated in multiple Phase 3 trials. However, Tβ4 is not currently approved as a drug for any indication in the US, EU, or UK. Non-ophthalmic forms remain investigational and are not approved for human use outside clinical trials.
-
In published Phase 3 clinical trials involving over 1,600 patients, RGN-259 (ophthalmic Tβ4) was generally well-tolerated with no serious adverse events attributed to the compound. For non-ophthalmic applications, safety data is limited to animal studies, which have not shown significant toxicity at therapeutic doses. The principal theoretical concern is Tβ4's angiogenic activity in individuals with active malignancy.
Related Pages
- tb 500 vs thymosin beta 4
- tb 500
- wound healing
- corneal repair
- cardiac repair
- healing stack
- healing peptides
- thymosin beta 4
- TB-500
Systemic tissue repair & angiogenesis
- BPC-157
Gastrointestinal protection & systemic tissue repair
- GHK-Cu
Skin regeneration & collagen synthesis