Skip to content
Thymosin Beta-4
Compound Profile

Thymosin Beta-4

Actin-sequestering, tissue repair & angiogenesis

Also known as: Tβ4 · TB4 · TMSB4X · thymosin β4

Reviewed by the CompoundGuide Editorial Team Last updated: Our methodology

Photo by Chokniti Khongchum / Pexels

Chemistry data
Class
naturally occurring 43-amino acid actin-sequestering peptide
Molecular weight
4921 g/mol
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids, acetylated N-terminus)
Half-life
estimated 2–6 hours in circulation (rapidly distributed to tissues)
Routes
ophthalmic (eye drops — RGN-259 clinical formulation) · topical · subcutaneous · intravenous
Studied doses
ophthalmic 0.1% RGN-259 solution, applied as eye drops (clinical trial formulation) · topical varies by study; typically applied directly to wound site in preclinical models

hat if part of the repair crew you're hoping to activate is already inside nearly every cell of your body — waiting for instructions? Thymosin Beta-4 (Tβ4) is a 43-amino acid protein found naturally in almost all human tissue, and research connects it to the levers regeneration depends on: cell migration via actin dynamics, angiogenesis, stem cell mobilization, and anti-inflammatory signaling PMID: 16099219 .

It also holds a milestone no other actin-binding peptide has reached: its ophthalmic formulation, RGN-259, has completed Phase 3 trials for corneal wound healing in neurotrophic keratopathy PMID: 36613994 . One clarification matters before anything else: full-length Tβ4 is not the same molecule as its famous synthetic fragment ** TB-500 TB-500 TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis **, which isolates just seven amino acids from the actin-binding domain PMID: 31333080 .

By the end of this page you'll know why that parent-versus-fragment difference matters, what the Phase 3 data actually showed, and precisely where the clinical evidence ends and the preclinical begins.

Regulatory Status

United States
Investigational New Drug
European Union
Investigational
United Kingdom
Investigational

What is this compound?

Thymosin Beta-4 first surfaced in 1981, when researchers cataloging the peptide components of "thymosin fraction 5" — a biochemical extract of bovine thymus — isolated a protein they initially studied for its influence on T-cell maturation. Its sequence was determined that same year: 43 residues, acetylated at the N-terminus, molecular weight approximately 4,921 daltons PMID: 6940133 .

Then came the plot twist. By the early 2000s, the field recognized that Tβ4 wasn't primarily an immune regulator at all — it was a master actin buffer. Found in all cell types except red blood cells, it binds monomeric G-actin and prevents polymerization into filamentous F-actin, placing it at the center of every cellular process that depends on cytoskeletal rearrangement: migration, division, wound closure, angiogenesis PMID: 16099219 .

The numbers show how fundamental this protein is. It is encoded by the TMSB4X gene on the X chromosome, is water-soluble and highly conserved across mammalian species, and reaches intracellular concentrations of 200–500 μM in some cell types — making it one of the most abundant cytoplasmic proteins in the body.

This scope is what distinguishes Thymosin Beta-4 from its synthetic derivative ** TB-500 TB-500 TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis . The fragment captures the seven actin-binding amino acids (the LKKTETQ sequence); Tβ4 does that and more — regulating DNA polymerase activity, promoting protein synthesis, influencing stem cell differentiation**, and driving broader extracellular matrix remodeling. Those functions require the full 43-amino acid structure and cannot be replicated by the isolated fragment [PMID: 22074294, PMID: 31333080].

Why does that extra machinery matter? Because it maps directly onto the four mechanisms that make this protein unusual — which is where the story gets interesting.

How it works

Every cell faces a paradox: it needs a rigid skeleton to hold its shape, yet it must dissolve that same skeleton to move, divide, or repair damage. Thymosin Beta-4 is the protein that manages this balance.

The central mechanism is G-actin sequestration. Actin exists in two pools: free monomers (G-actin) and polymerized filaments (F-actin) forming the cell's structural framework. Tβ4 binds G-actin monomers with high affinity, keeping them soluble and non-polymerized. When a cell needs to migrate — toward a wound, for instance — it locally releases Tβ4's grip, allowing rapid filament assembly at the leading edge. Picture a controlled supply-and-demand warehouse for cytoskeletal parts, opened on command PMID: 16099219 .

Repair also needs plumbing, and Tβ4 delivers it through angiogenesis: upregulation of VEGF (vascular endothelial growth factor) and stabilization of HIF-1α (hypoxia-inducible factor), both of which drive vessel formation in oxygen-deprived tissues PMID: 22074294 . In animal models, this translates to measurably increased vascular density at injury sites.

Meanwhile, a second hand calms the storm. Tβ4 suppresses NF-κB, the transcription factor orchestrating the inflammatory cascade, reducing pro-inflammatory cytokine production and limiting tissue damage from excessive immune activation PMID: 31333080 . Because this anti-inflammatory effect operates in parallel with repair signaling, the rebuild doesn't have to wait for inflammation to fully resolve.

A fourth layer, increasingly recognized in the literature, is stem cell mobilization: Tβ4 promotes migration and differentiation of progenitor cells, including those forming new vessels and regenerating damaged tissue PMID: 22074294 . Migration, blood supply, inflammation control, fresh cellular recruits — assemble those four pieces and you can see why researchers carried this protein all the way into human trials.

Research Findings

The headline result lives in ophthalmology. RGN-259, a sterile preservative-free eye drop formulation containing 0.1% Tβ4, has been evaluated in multiple Phase 3 clinical trials — dry eye disease (the ARISE program, more than 1,600 patients) and neurotrophic keratopathy (the SEER trials). In SEER-1, 60% of RGN-259-treated patients achieved complete corneal healing: 6 in 10 people whose corneas had struggled to heal on their own. In the most recent published trial, treated subjects showed statistically significant healing with no recurrence of epithelial defects after treatment cessation PMID: 36613994 . Whatever else the research holds, this established Tβ4 as a genuine clinical-stage compound — not merely a research curiosity.

Wound-healing evidence runs broader but stays preclinical. Animal models associate Tβ4 administration with accelerated wound closure, improved collagen deposition, enhanced epithelialization, and better-organized scar tissue [PMID: 22074294, PMID: 20536453] — the combined work of all four mechanisms described above: migrating cells, new blood supply, dampened inflammation, recruited progenitors.

Cardiac repair is among the most active preclinical frontiers. Tβ4 promotes cardiomyocyte migration and survival in culture, and in animal models of myocardial infarction it has been associated with reduced infarct size and improved cardiac function PMID: 22074294 , apparently via mobilization of epicardial progenitor cells and revascularization of damaged myocardium. Human trials haven't tested these findings yet — that gap is the whole story of this section.

One finding reliably surprises people: in normal and aged rodents, Tβ4 promoted hair follicle growth and cycling PMID: 20536453 , seemingly through dermal papilla cell migration and follicle-level angiogenesis. From cornea to heart muscle to hair — the breadth naturally leads to the practical question of dosing.

Dosage Context Explained

Tβ4 has traveled further toward clinical dosing than most regenerative peptides — but the map is still drawn narrowly.

The most precise data comes from ophthalmic research. RGN-259 is formulated as a 0.1% sterile, preservative-free solution applied as eye drops, with protocols varying between trials for dry eye disease and neurotrophic keratopathy. In SEER-1, patients received the drops on a defined schedule over four weeks PMID: 36613994 .

Beyond the eye, dosing knowledge comes almost exclusively from preclinical animal models. Topical wound application and subcutaneous injection have both been studied, but doses vary substantially by species, body weight, and experimental design — no standardized systemic protocols exist for humans.

Here's the distinction that matters most: unlike ** TB-500 TB-500 TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis **, which outside controlled research has only anecdotal human-use reports, Tβ4 has actual clinical trial data — confined to ophthalmic formulations. Extrapolation from corneal drops to systemic or injection-based use remains unsupported by controlled human evidence, and that gap is exactly why the safety picture deserves a careful look next.

  • Administration Routes
    ophthalmic
    Range
    0.1% RGN-259 solution, applied as eye drops (clinical trial formulation)

    Phase 3 clinical trials for neurotrophic keratopathy and dry eye disease

  • Administration Routes
    topical
    Range
    varies by study; typically applied directly to wound site in preclinical models

    animal wound-healing studies

Reconstitution Calculator

Determine exactly how much bacteriostatic water to add and how many units to draw for your target dose.

Open Calculator →

Side Effects: Research Context

On the evidence available, Tβ4's safety profile ranks among the most favorable of any regenerative peptide in clinical development.

Across the Phase 3 RGN-259 trials involving over 1,600 patients, the eye drops were generally well tolerated, with no serious adverse events attributed to the compound PMID: 36613994 . Mild ocular discomfort was reported by some participants, but it resolved on its own and never required discontinuing treatment.

Outside the eye, the data returns to preclinical territory: animal studies have not revealed significant toxicity at therapeutic doses, but no human clinical trials exist for injectable or systemic Tβ4 use.

The theoretical flag researchers watch involves Tβ4's angiogenic and growth-promoting mechanisms. A protein that stimulates blood vessel formation and cell proliferation could, in principle, promote tumor growth in individuals with active malignancy PMID: 31333080 . Worth stressing: this concern rests on mechanistic reasoning rather than clinical observation — no tumor-promoting effects have been documented in published trials — but it warrants caution in any future systemic application. With safety framed, the natural next stop is the regulatory map.

  • generally well-tolerated in clinical trials (ophthalmic formulation)
  • mild ocular discomfort reported in some RGN-259 trial participants (self-resolving)
  • no serious adverse events attributed to Tβ4 in published Phase 3 data

Frequently Asked Questions

Frequently Asked Questions

Thymosin Beta-4 (Tβ4) is a naturally occurring 43-amino acid protein encoded by the TMSB4X gene, found in virtually every cell type in the body. TB-500 is a synthetic seven-amino acid fragment (LKKTETQ) derived from Tβ4's actin-binding domain. While TB-500 captures the core actin-sequestering function, Tβ4 retains additional biological capabilities — including regulation of DNA polymerase, promotion of protein synthesis, stem cell mobilization, and broader extracellular matrix remodeling — that require the full-length protein structure.

Tβ4 primarily functions as a G-actin sequestration protein: it binds monomeric actin and prevents polymerization into filaments, maintaining a dynamic pool of available actin for cytoskeletal rearrangement during cell migration and wound closure. Beyond this, Tβ4 promotes angiogenesis through VEGF and HIF-1α pathways, suppresses NF-κB-mediated inflammation, supports anti-apoptotic signaling, and mobilizes stem/progenitor cells for tissue regeneration.

Yes. RGN-259, an ophthalmic formulation of Tβ4, has completed Phase 3 clinical trials for both dry eye disease (the ARISE program, over 1,600 patients) and neurotrophic keratopathy (the SEER trials). Results showed statistically significant improvements in corneal healing and ocular comfort. Tβ4 is the first actin-binding peptide to reach Phase 3 clinical development. Non-ophthalmic applications remain in preclinical stages.

Tβ4's ophthalmic formulation (RGN-259) holds Investigational New Drug status with the FDA and has been evaluated in multiple Phase 3 trials. However, Tβ4 is not currently approved as a drug for any indication in the US, EU, or UK. Non-ophthalmic forms remain investigational and are not approved for human use outside clinical trials.

In published Phase 3 clinical trials involving over 1,600 patients, RGN-259 (ophthalmic Tβ4) was generally well-tolerated with no serious adverse events attributed to the compound. For non-ophthalmic applications, safety data is limited to animal studies, which have not shown significant toxicity at therapeutic doses. The principal theoretical concern is Tβ4's angiogenic activity in individuals with active malignancy.

Related Pages