Skip to content
Thymosin Beta-4
Compound Profile

Thymosin Beta-4

Actin-sequestering, tissue repair & angiogenesis

Also known as: Tβ4 · TB4 · TMSB4X · thymosin β4

Reviewed by the CompoundGuide Editorial Team Last updated: Our methodology

Photo by Chokniti Khongchum / Pexels

Chemistry data
Class
naturally occurring 43-amino acid actin-sequestering peptide
Molecular weight
4921 g/mol
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids, acetylated N-terminus)
Half-life
estimated 2–6 hours in circulation (rapidly distributed to tissues)
Routes
ophthalmic (eye drops — RGN-259 clinical formulation) · topical · subcutaneous · intravenous
Studied doses
ophthalmic 0.1% RGN-259 solution, applied as eye drops (clinical trial formulation) · topical varies by study; typically applied directly to wound site in preclinical models

here most tissue-repair peptides act on a single pathway, Thymosin Beta-4 (Tβ4) operates at the intersection of several. This 43-amino acid protein exists naturally in virtually every cell in the body — and its influence extends from actin dynamics to angiogenesis, stem cell mobilization, and anti-inflammatory signaling PMID: 16099219 .

Unlike its synthetic fragment ** TB-500 TB-500 TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis , which isolates just seven amino acids from the actin-binding domain, Tβ4** is the full-length parent protein. It retains the actin-sequestering function but adds regulatory roles that the fragment cannot replicate — including DNA polymerase modulation and broader extracellular matrix remodeling PMID: 31333080 .

This breadth is why Thymosin Beta-4 has advanced further than most regenerative peptides in clinical development. Its ophthalmic formulation, RGN-259, has completed Phase 3 trials for corneal wound healing in neurotrophic keratopathy PMID: 36613994 — a milestone no other actin-binding peptide has reached.

Regulatory Status

United States
Investigational New Drug
European Union
Investigational
United Kingdom
Investigational

What is this compound?

Thymosin Beta-4 was first isolated in 1981 from bovine thymus tissue, when researchers were cataloging the peptide components of what they called "thymosin fraction 5." The original interest was immunological — the protein appeared to influence T-cell maturation. Its amino acid sequence was determined that same year: 43 residues, acetylated at the N-terminus, with a molecular weight of approximately 4,921 daltons PMID: 6940133 .

It took another two decades for the field to recognize what Tβ4 was actually doing. By the early 2000s, researchers had established that the protein was not primarily an immune regulator — it was a master actin buffer. Found in all cell types except red blood cells, Tβ4 binds to monomeric G-actin and prevents it from polymerizing into filamentous F-actin. This single function places Tβ4 at the center of every cellular process that depends on cytoskeletal rearrangement: migration, division, wound closure, angiogenesis PMID: 16099219 .

The protein is encoded by the TMSB4X gene on the X chromosome. It is water-soluble, highly conserved across mammalian species, and present at intracellular concentrations that can reach 200–500 μM in some cell types — making it one of the most abundant cytoplasmic proteins in the body.

What distinguishes Thymosin Beta-4 from its synthetic derivative ** TB-500 TB-500 TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis is scope. TB-500 captures the seven amino acids responsible for actin binding (the LKKTETQ sequence). Tβ4 does that and more: it regulates DNA polymerase activity, promotes protein synthesis, and influences stem cell differentiation** — functions that require the full 43-amino acid structure and cannot be replicated by the isolated fragment [PMID: 22074294, PMID: 31333080].

How it works

Every cell in the body faces a fundamental tension: it needs a rigid skeleton to maintain its shape, but it also needs to dissolve that skeleton to move, divide, or repair damage. Thymosin Beta-4 is the protein that manages this balance.

The central mechanism is G-actin sequestration. Actin exists in two pools: free monomers (G-actin) and polymerized filaments (F-actin) that form the structural framework of the cell. Tβ4 binds to G-actin monomers with high affinity, keeping them in a soluble, non-polymerized state. When a cell needs to migrate — toward a wound, for instance — it locally releases Tβ4's grip on actin, allowing rapid filament assembly at the leading edge. This controlled supply-and-demand system gives cells the flexibility to reorganize their cytoskeleton on command PMID: 16099219 .

Beyond cytoskeletal regulation, Tβ4 promotes angiogenesis — the growth of new blood vessels. It does this through upregulation of VEGF (vascular endothelial growth factor) and stabilization of HIF-1α (hypoxia-inducible factor), both of which drive vessel formation in oxygen-deprived tissues PMID: 22074294 . In animal models, this has translated to measurably increased vascular density at injury sites.

Tβ4 also suppresses NF-κB, the transcription factor that orchestrates the inflammatory cascade. By dampening this pathway, the protein reduces the production of pro-inflammatory cytokines and limits tissue damage from excessive immune activation PMID: 31333080 . This anti-inflammatory effect operates in parallel with its repair mechanisms — the cell can begin rebuilding without waiting for inflammation to fully resolve.

A fourth mechanism, increasingly recognized in the literature, is Tβ4's role in stem cell mobilization. The protein promotes the migration and differentiation of progenitor cells, including those that form new blood vessels and regenerate damaged tissue PMID: 22074294 . This positions Tβ4 not just as a repair molecule, but as a signal that recruits the body's own regenerative capacity.

Research Findings

The most advanced clinical evidence for Thymosin Beta-4 exists in ophthalmology. RGN-259, a sterile preservative-free eye drop formulation containing 0.1% Tβ4, has been evaluated in multiple Phase 3 clinical trials for dry eye disease (the ARISE program, >1,600 patients) and neurotrophic keratopathy (the SEER trials). In SEER-1, 60% of RGN-259-treated patients achieved complete corneal healing, and in the most recent published trial, Tβ4-treated subjects showed statistically significant healing with no recurrence of epithelial defects after treatment cessation PMID: 36613994 . These results established Tβ4 as a genuine clinical-stage compound — not merely a research curiosity.

For wound healing more broadly, the preclinical evidence is extensive. In animal models, Tβ4 administration has been associated with accelerated wound closure, improved collagen deposition, enhanced epithelialization, and better-organized scar tissue [PMID: 22074294, PMID: 20536453]. The mechanism combines all four of Tβ4's primary functions: actin-mediated cell migration toward the wound bed, new blood vessel formation to supply the repair site, anti-inflammatory suppression to reduce collateral damage, and stem cell recruitment to generate new tissue.

Cardiac repair represents a particularly active area of preclinical investigation. Tβ4 promotes cardiomyocyte migration and survival in culture, and in animal models of myocardial infarction, it has been associated with reduced infarct size and improved cardiac function PMID: 22074294 . The proposed mechanism involves Tβ4's ability to mobilize epicardial progenitor cells and promote revascularization of damaged myocardium. These findings have not yet been tested in human clinical trials.

Hair growth is another preclinical finding: Tβ4 has been shown to promote hair follicle growth and cycling in both normal and aged rodents PMID: 20536453 . The mechanism appears to involve dermal papilla cell migration and angiogenesis at the follicular level.

Dosage Context Explained

Thymosin Beta-4 has progressed further toward clinical dosing than most regenerative peptides, but the available data remains limited.

The most precise dosing information comes from ophthalmic clinical trials. RGN-259 is formulated as a 0.1% sterile, preservative-free solution applied as eye drops, with dosing protocols varying between trials for dry eye disease and neurotrophic keratopathy. In the SEER-1 trial for neurotrophic keratopathy, patients received the drops according to a defined schedule over four weeks PMID: 36613994 .

For non-ophthalmic applications, dosing data comes almost exclusively from preclinical animal models. Topical application to wound sites and subcutaneous injection have both been studied, but doses vary substantially by species, body weight, and experimental design. No standardized dosing protocols exist for systemic administration in humans.

The critical distinction: unlike ** TB-500 TB-500 TB-500 synthetic heptapeptide fragment (actin-binding domain of Thymosin Beta-4) Systemic tissue repair & angiogenesis **, which has only anecdotal human-use reports outside of controlled research, Tβ4 has actual clinical trial data — albeit limited to ophthalmic formulations. Extrapolation from corneal application to systemic or injection-based use remains unsupported by controlled human evidence.

  • Administration Routes
    ophthalmic
    Range
    0.1% RGN-259 solution, applied as eye drops (clinical trial formulation)

    Phase 3 clinical trials for neurotrophic keratopathy and dry eye disease

  • Administration Routes
    topical
    Range
    varies by study; typically applied directly to wound site in preclinical models

    animal wound-healing studies

🧮 Reconstitution Calculator

Determine exactly how much bacteriostatic water to add and how many units to draw for your target dose.

Open Calculator →

Side Effects: Research Context

The safety profile of Thymosin Beta-4 is among the most favorable of any regenerative peptide in clinical development, based on available data.

In the Phase 3 RGN-259 clinical trials involving over 1,600 patients, Tβ4 eye drops were generally well-tolerated, with no serious adverse events attributed to the compound PMID: 36613994 . Mild ocular discomfort was reported by some participants but was self-resolving and did not require treatment discontinuation.

For non-ophthalmic applications, safety data is limited to preclinical models. Animal studies have not revealed significant toxicity at therapeutic doses, but no human clinical trials exist for injectable or systemic Tβ4 use.

The principal theoretical concern remains Tβ4's angiogenic and growth-promoting mechanisms. Because the protein stimulates blood vessel formation and cell proliferation, there is a theoretical risk that it could promote tumor growth in individuals with active malignancy PMID: 31333080 . This contraindication is based on mechanistic reasoning rather than clinical observation — no tumor-promoting effects have been documented in published trials — but it warrants caution in any future systemic application.

  • generally well-tolerated in clinical trials (ophthalmic formulation)
  • mild ocular discomfort reported in some RGN-259 trial participants (self-resolving)
  • no serious adverse events attributed to Tβ4 in published Phase 3 data

Frequently Asked Questions

Frequently Asked Questions

Related Pages